ITFG3 antibody

• Supplier: Fitzgerald
• Catalog: 70R-6769
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: ITFG3 antibody was raised using the middle region of ITFG3 corresponding to a region with amino acids RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA
• Purity/Format: Affinity purified
• Blocking Peptide: ITFG3 Blocking Peptide
• Description: Rabbit polyclonal ITFG3 antibody raised against the middle region of ITFG3
• Gene: ITFG3