NDUFS1 antibody

Name NDUFS1 antibody
Supplier Fitzgerald
Catalog 70R-3459
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NDUFS1 antibody was raised using the middle region of NDUFS1 corresponding to a region with amino acids TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
Purity/Format Affinity purified
Blocking Peptide NDUFS1 Blocking Peptide
Description Rabbit polyclonal NDUFS1 antibody raised against the middle region of NDUFS1
Gene NDUFS1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.