ELMOD2 antibody

Name ELMOD2 antibody
Supplier Fitzgerald
Catalog 70R-6024
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN
Purity/Format Affinity purified
Blocking Peptide ELMOD2 Blocking Peptide
Description Rabbit polyclonal ELMOD2 antibody raised against the N terminal of ELMOD2
Gene ELMOD2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.