| Name | RPL13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1470 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | RPL13 antibody was raised using the C terminal of RPL13 corresponding to a region with amino acids KGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RPL13 Blocking Peptide |
| Description | Rabbit polyclonal RPL13 antibody raised against the C terminal of RPL13 |
| Gene | RPL13 |
| Supplier Page | Shop |