Name | C12ORF53 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7540 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | C12ORF53 antibody was raised using the middle region of C12Orf53 corresponding to a region with amino acids VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI |
Purity/Format | Affinity purified |
Blocking Peptide | C12ORF53 Blocking Peptide |
Description | Rabbit polyclonal C12ORF53 antibody raised against the middle region of C12Orf53 |
Gene | PIANP |
Supplier Page | Shop |