Name | EPS8 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3683 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | EPS8 antibody was raised using the middle region of EPS8 corresponding to a region with amino acids VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH |
Purity/Format | Affinity purified |
Blocking Peptide | EPS8 Blocking Peptide |
Description | Rabbit polyclonal EPS8 antibody raised against the middle region of EPS8 |
Gene | EPS8 |
Supplier Page | Shop |