Tetraspanin 31 antibody

• Supplier: Fitzgerald
• Catalog: 70R-7187
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR
• Purity/Format: Affinity purified
• Blocking Peptide: Tetraspanin 31 Blocking Peptide
• Description: Rabbit polyclonal Tetraspanin 31 antibody raised against the middle region of TSPAN31
• Gene: TSPAN31