| Name | EIF3EIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4419 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | EIF3EIP antibody was raised using the N terminal of EIF3EIP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV |
| Purity/Format | Affinity purified |
| Blocking Peptide | EIF3EIP Blocking Peptide |
| Description | Rabbit polyclonal EIF3EIP antibody raised against the N terminal of EIF3EIP |
| Gene | EIF3L |
| Supplier Page | Shop |