Name | EIF3EIP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4419 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | EIF3EIP antibody was raised using the N terminal of EIF3EIP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV |
Purity/Format | Affinity purified |
Blocking Peptide | EIF3EIP Blocking Peptide |
Description | Rabbit polyclonal EIF3EIP antibody raised against the N terminal of EIF3EIP |
Gene | EIF3L |
Supplier Page | Shop |