| Name | CLIC5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1502 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CLIC5 Blocking Peptide |
| Description | Rabbit polyclonal CLIC5 antibody raised against the C terminal of CLIC5 |
| Gene | CLIC5 |
| Supplier Page | Shop |