| Name | FAM83E antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3875 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM83E antibody was raised using the middle region of FAM83E corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM83E Blocking Peptide |
| Description | Rabbit polyclonal FAM83E antibody raised against the middle region of FAM83E |
| Gene | FAM83E |
| Supplier Page | Shop |