Name | FAM83E antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3875 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM83E antibody was raised using the middle region of FAM83E corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM |
Purity/Format | Affinity purified |
Blocking Peptide | FAM83E Blocking Peptide |
Description | Rabbit polyclonal FAM83E antibody raised against the middle region of FAM83E |
Gene | FAM83E |
Supplier Page | Shop |