| Name | PURB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4611 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV |
| Purity/Format | Affinity purified |
| Blocking Peptide | PURB Blocking Peptide |
| Description | Rabbit polyclonal PURB antibody raised against the N terminal of PURB |
| Gene | PURB |
| Supplier Page | Shop |