| Name | GJC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1696 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | GJC1 Blocking Peptide |
| Description | Rabbit polyclonal GJC1 antibody raised against the N terminal of GJC1 |
| Gene | GJD3 |
| Supplier Page | Shop |