| Name | USP48 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6673 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS |
| Purity/Format | Affinity purified |
| Blocking Peptide | USP48 Blocking Peptide |
| Description | Rabbit polyclonal USP48 antibody raised against the C terminal of USP48 |
| Gene | USP48 |
| Supplier Page | Shop |