TMEM9 antibody

Name TMEM9 antibody
Supplier Fitzgerald
Catalog 70R-7412
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS
Purity/Format Affinity purified
Blocking Peptide TMEM9 Blocking Peptide
Description Rabbit polyclonal TMEM9 antibody raised against the C terminal of TMEM9
Gene TMEM9
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.