| Name | TRAM2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6865 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRAM2 Blocking Peptide |
| Description | Rabbit polyclonal TRAM2 antibody raised against the N terminal of TRAM2 |
| Gene | TRAM2 |
| Supplier Page | Shop |