| Name | FAM82B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4099 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM82B antibody was raised using the N terminal of FAM82B corresponding to a region with amino acids MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM82B Blocking Peptide |
| Description | Rabbit polyclonal FAM82B antibody raised against the N terminal of FAM82B |
| Gene | RMDN1 |
| Supplier Page | Shop |