Name | RPS15A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3009 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RPS15A antibody was raised using the middle region of RPS15A corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH |
Purity/Format | Affinity purified |
Blocking Peptide | RPS15A Blocking Peptide |
Description | Rabbit polyclonal RPS15A antibody raised against the middle region of RPS15A |
Gene | RPS15 |
Supplier Page | Shop |