| Name | RPS15A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3009 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPS15A antibody was raised using the middle region of RPS15A corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPS15A Blocking Peptide |
| Description | Rabbit polyclonal RPS15A antibody raised against the middle region of RPS15A |
| Gene | RPS15 |
| Supplier Page | Shop |