LOXL1 antibody

• Supplier: Fitzgerald
• Catalog: 70R-5381
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat
• Antigen: LOXL1 antibody was raised using the middle region of LOXL1 corresponding to a region with amino acids YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP
• Purity/Format: Affinity purified
• Blocking Peptide: LOXL1 Blocking Peptide
• Description: Rabbit polyclonal LOXL1 antibody raised against the middle region of LOXL1
• Gene: LOXL1