| Name | MAOA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2464 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | MAOA antibody was raised using the N terminal of MAOA corresponding to a region with amino acids GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAOA Blocking Peptide |
| Description | Rabbit polyclonal MAOA antibody raised against the N terminal of MAOA |
| Gene | MAOA |
| Supplier Page | Shop |