Name | CYB561 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7064 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ |
Purity/Format | Affinity purified |
Blocking Peptide | CYB561 Blocking Peptide |
Description | Rabbit polyclonal CYB561 antibody raised against the middle region of CYB561 |
Gene | CYB561 |
Supplier Page | Shop |