| Name | RXRG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1925 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH |
| Purity/Format | Affinity purified |
| Blocking Peptide | RXRG Blocking Peptide |
| Description | Rabbit polyclonal RXRG antibody raised against the N terminal of RXRG |
| Gene | RXRG |
| Supplier Page | Shop |