Name | RXRG antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1925 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH |
Purity/Format | Affinity purified |
Blocking Peptide | RXRG Blocking Peptide |
Description | Rabbit polyclonal RXRG antibody raised against the N terminal of RXRG |
Gene | RXRG |
Supplier Page | Shop |