| Name | GNPDA1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3271 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, C. elegans |
| Antigen | GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | GNPDA1 Blocking Peptide |
| Description | Rabbit polyclonal GNPDA1 antibody raised against the C terminal of GNPDA1 |
| Gene | GNPDA1 |
| Supplier Page | Shop |