| Name | GALNT13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7449 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GALNT13 antibody was raised using the N terminal Of Galnt13 corresponding to a region with amino acids CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI |
| Purity/Format | Affinity purified |
| Blocking Peptide | GALNT13 Blocking Peptide |
| Description | Rabbit polyclonal GALNT13 antibody raised against the N terminal Of Galnt13 |
| Gene | GALNT13 |
| Supplier Page | Shop |