| Name | SCN3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5225 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SCN3B antibody was raised using the N terminal of SCN3B corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND |
| Purity/Format | Affinity purified |
| Blocking Peptide | SCN3B Blocking Peptide |
| Description | Rabbit polyclonal SCN3B antibody raised against the N terminal of SCN3B |
| Gene | SCN3B |
| Supplier Page | Shop |