| Name | MMP23B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6358 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP |
| Purity/Format | Affinity purified |
| Blocking Peptide | MMP23B Blocking Peptide |
| Description | Rabbit polyclonal MMP23B antibody raised against the N terminal of MMP23B |
| Gene | MMP23B |
| Supplier Page | Shop |