Name | MMP23B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6358 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP |
Purity/Format | Affinity purified |
Blocking Peptide | MMP23B Blocking Peptide |
Description | Rabbit polyclonal MMP23B antibody raised against the N terminal of MMP23B |
Gene | MMP23B |
Supplier Page | Shop |