ATL3 antibody

Name ATL3 antibody
Supplier Fitzgerald
Catalog 70R-5964
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ATL3 antibody was raised using the middle region of Dkfzp564J0863 corresponding to a region with amino acids DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
Purity/Format Affinity purified
Blocking Peptide ATL3 Blocking Peptide
Description Rabbit polyclonal ATL3 antibody raised against the middle region of Dkfzp564J0863
Gene ATL3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.