| Name | PUF60 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1411 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PUF60 Blocking Peptide |
| Description | Rabbit polyclonal PUF60 antibody raised against the C terminal of PUF60 |
| Gene | PUF60 |
| Supplier Page | Shop |