| Name | NARG1L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2694 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NARG1L antibody was raised using the middle region of NARG1L corresponding to a region with amino acids RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL |
| Purity/Format | Affinity purified |
| Blocking Peptide | NARG1L Blocking Peptide |
| Description | Rabbit polyclonal NARG1L antibody raised against the middle region of NARG1L |
| Gene | NAA16 |
| Supplier Page | Shop |