ADAM30 antibody

Name ADAM30 antibody
Supplier Fitzgerald
Catalog 70R-7288
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH
Purity/Format Affinity purified
Blocking Peptide ADAM30 Blocking Peptide
Description Rabbit polyclonal ADAM30 antibody raised against the N terminal of ADAM30
Gene ADAM30
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.