| Name | KAP11.1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3239 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KAP11.1 antibody was raised using the N terminal of KRTAP11-1 corresponding to a region with amino acids SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW |
| Purity/Format | Affinity purified |
| Blocking Peptide | KAP11.1 Blocking Peptide |
| Description | Rabbit polyclonal KAP11.1 antibody raised against the N terminal of KRTAP11-1 |
| Gene | KRTAP11-1 |
| Supplier Page | Shop |