| Name | FAM81B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4168 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM81B antibody was raised using the N terminal of FAM81B corresponding to a region with amino acids MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM81B Blocking Peptide |
| Description | Rabbit polyclonal FAM81B antibody raised against the N terminal of FAM81B |
| Gene | FAM81B |
| Supplier Page | Shop |