| Name | Annexin A10 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6037 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE |
| Purity/Format | Affinity purified |
| Blocking Peptide | Annexin A10 Blocking Peptide |
| Description | Rabbit polyclonal Annexin A10 antibody raised against the middle region of ANXA10 |
| Gene | ANXA10 |
| Supplier Page | Shop |