| Name | OR6C68 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6774 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OR6C68 antibody was raised using the N terminal of OR6C68 corresponding to a region with amino acids MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA |
| Purity/Format | Affinity purified |
| Blocking Peptide | OR6C68 Blocking Peptide |
| Description | Rabbit polyclonal OR6C68 antibody raised against the N terminal of OR6C68 |
| Gene | OR6C68 |
| Supplier Page | Shop |