Name | OR6C68 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6774 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | OR6C68 antibody was raised using the N terminal of OR6C68 corresponding to a region with amino acids MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA |
Purity/Format | Affinity purified |
Blocking Peptide | OR6C68 Blocking Peptide |
Description | Rabbit polyclonal OR6C68 antibody raised against the N terminal of OR6C68 |
Gene | OR6C68 |
Supplier Page | Shop |