| Name | RGS4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5834 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RGS4 antibody was raised using the C terminal of RGS4 corresponding to a region with amino acids EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RGS4 Blocking Peptide |
| Description | Rabbit polyclonal RGS4 antibody raised against the C terminal of RGS4 |
| Gene | RGS4 |
| Supplier Page | Shop |