LYPLA1 antibody

Name LYPLA1 antibody
Supplier Fitzgerald
Catalog 70R-2373
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
Purity/Format Affinity purified
Blocking Peptide LYPLA1 Blocking Peptide
Description Rabbit polyclonal LYPLA1 antibody raised against the middle region of LYPLA1
Gene LYPLA1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.