Name | OLFML2A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4200 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS |
Purity/Format | Affinity purified |
Blocking Peptide | OLFML2A Blocking Peptide |
Description | Rabbit polyclonal OLFML2A antibody raised against the N terminal of OLFML2A |
Gene | OLFML2A |
Supplier Page | Shop |