RPLP0 antibody

Name RPLP0 antibody
Supplier Fitzgerald
Catalog 70R-4936
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RPLP0 antibody was raised using the N terminal of RPLP0 corresponding to a region with amino acids TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT
Purity/Format Affinity purified
Blocking Peptide RPLP0 Blocking Peptide
Description Rabbit polyclonal RPLP0 antibody raised against the N terminal of RPLP0
Gene RPLP0
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.