TMEM57 antibody

Name TMEM57 antibody
Supplier Fitzgerald
Catalog 70R-6614
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen TMEM57 antibody was raised using the N terminal of TMEM57 corresponding to a region with amino acids VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAF
Purity/Format Affinity purified
Blocking Peptide TMEM57 Blocking Peptide
Description Rabbit polyclonal TMEM57 antibody raised against the N terminal of TMEM57
Gene TMEM57
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.