SH3BGRL antibody

Name SH3BGRL antibody
Supplier Fitzgerald
Catalog 70R-3848
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Purity/Format Affinity purified
Blocking Peptide SH3BGRL Blocking Peptide
Description Rabbit polyclonal SH3BGRL antibody raised against the middle region of SH3BGRL
Gene SH3BGRL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.