| Name | SH3BGRL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3848 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
| Purity/Format | Affinity purified |
| Blocking Peptide | SH3BGRL Blocking Peptide |
| Description | Rabbit polyclonal SH3BGRL antibody raised against the middle region of SH3BGRL |
| Gene | SH3BGRL |
| Supplier Page | Shop |