Name | SH3BGRL antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3848 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
Purity/Format | Affinity purified |
Blocking Peptide | SH3BGRL Blocking Peptide |
Description | Rabbit polyclonal SH3BGRL antibody raised against the middle region of SH3BGRL |
Gene | SH3BGRL |
Supplier Page | Shop |