LRPAP1 antibody

Name LRPAP1 antibody
Supplier Fitzgerald
Catalog 70R-1861
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen LRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH
Purity/Format Total IgG Protein A purified
Blocking Peptide LRPAP1 Blocking Peptide
Description Rabbit polyclonal LRPAP1 antibody raised against the C terminal of LRPAP1
Gene LRPAP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.