Carbonic Anhydrase VIII antibody

• Supplier: Fitzgerald
• Catalog: 70R-1122
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat, Dog, Zebrafish
• Antigen: Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: Carbonic Anhydrase VIII Blocking Peptide
• Description: Rabbit polyclonal Carbonic Anhydrase VIII antibody raised against the N terminal of CA8
• Gene: CA8