| Name | PPP2R5A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2950 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PPP2R5A antibody was raised using the N terminal of PPP2R5A corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP2R5A Blocking Peptide |
| Description | Rabbit polyclonal PPP2R5A antibody raised against the N terminal of PPP2R5A |
| Gene | PPP2R5A |
| Supplier Page | Shop |