| Name | C10ORF57 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7192 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C10ORF57 antibody was raised using the middle region of C10Orf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH |
| Purity/Format | Affinity purified |
| Blocking Peptide | C10ORF57 Blocking Peptide |
| Description | Rabbit polyclonal C10ORF57 antibody raised against the middle region of C10Orf57 |
| Gene | TMEM254 |
| Supplier Page | Shop |