| Name | KCNRG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1507 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KCNRG Blocking Peptide |
| Description | Rabbit polyclonal KCNRG antibody raised against the N terminal of KCNRG |
| Gene | KCNRG |
| Supplier Page | Shop |