| Name | C14ORF130 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1154 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | C14ORF130 antibody was raised using the C terminal Of C14Orf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | C14ORF130 Blocking Peptide |
| Description | Rabbit polyclonal C14ORF130 antibody raised against the C terminal Of C14Orf130 |
| Gene | UBR7 |
| Supplier Page | Shop |