| Name | LOC388969 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3528 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LOC388969 antibody was raised using the N terminal Of Loc388969 corresponding to a region with amino acids VRRRHTPAPTRPRKPDLQVYLPRHRDVSAHPRNPDYEESGESSSSGGSEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | LOC388969 Blocking Peptide |
| Description | Rabbit polyclonal LOC388969 antibody raised against the N terminal Of Loc388969 |
| Gene | C2orf68 |
| Supplier Page | Shop |