Name | C1ORF159 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7031 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C1ORF159 antibody was raised using the C terminal Of C1Orf159 corresponding to a region with amino acids PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV |
Purity/Format | Affinity purified |
Blocking Peptide | C1ORF159 Blocking Peptide |
Description | Rabbit polyclonal C1ORF159 antibody raised against the C terminal Of C1Orf159 |
Gene | C1orf159 |
Supplier Page | Shop |