| Name | NMUR2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1539 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NMUR2 Blocking Peptide |
| Description | Rabbit polyclonal NMUR2 antibody raised against the N terminal of NMUR2 |
| Gene | NMUR2 |
| Supplier Page | Shop |